Products

HMGB2, Human (mammalian cell expression)

HMGB2 is a member of the non-histone chromosomal high-mobility group protein family, which are chromatin-associated and wildly expressed in the nucleus of higher eukaryotic cells. HMGB2 can assist cooperative interactions between cis-acting proteins by promoting DNA flexibility through bending DNA to DNA circles. In addition, HMGB2 participates in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination.
No. Size Price Qty Status
C01175-5UG 5 ug $144.00 Inquiry
C01175-20UG 20 ug $360.00 Inquiry
C01175-100UG 100 ug $712.80 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence:
MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKK
KDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSK
KKNEPEDEEEEEEEEDEDEEEEDEDEE with polyhistidine-SUMO tag at the N-terminus

UnitProt ID:
P26583
 
Source:
HEK293
 
Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.
 
Purity:
>98% as determined by SDS-PAGE. 

Form:
Lyophilized

Storage Buffer:
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.

Shipping Conditions:
Blue ice
Reviews for HMGB2, Human (mammalian cell expression)

Average Rating: 0 (0 Reviews )